SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018867 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018867
Domain Number 1 Region: 8-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000011
Family LIM domain 0.0099
Further Details:      
 
Domain Number 2 Region: 189-255
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000006
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 68-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000105
Family LIM domain 0.0071
Further Details:      
 
Domain Number 4 Region: 130-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000174
Family LIM domain 0.0078
Further Details:      
 
Domain Number 5 Region: 251-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000106
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018867   Gene: ENSPPYG00000016855   Transcript: ENSPPYT00000019613
Sequence length 284
Comment pep:known chromosome:PPYG2:6:98016220:98028563:1 gene:ENSPPYG00000016855 transcript:ENSPPYT00000019613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYHHVFSNYCEECKKPIESDSKDLCYKDR
HWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKG
NYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQ
LWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYASKCVACSKPISGLTGAKFICF
QDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
Download sequence
Identical sequences H2PJU8
ENSPPYP00000018867 9600.ENSPPYP00000018867 XP_002817209.2.23681 XP_002817211.1.23681 ENSPPYP00000018867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]