SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019084 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000019084
Domain Number - Region: 476-548
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0259
Family Di-heme elbow motif 0.071
Further Details:      
 
Domain Number - Region: 610-640
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0299
Family A20-like zinc finger 0.051
Further Details:      
 
Domain Number - Region: 661-698
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0627
Family A20-like zinc finger 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019084   Gene: ENSPPYG00000017042   Transcript: ENSPPYT00000019836
Sequence length 790
Comment pep:known chromosome:PPYG2:6:140732958:140749012:1 gene:ENSPPYG00000017042 transcript:ENSPPYT00000019836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSLPQLSLMDVKCETPNCPFFMSVNTKPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEEPAGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSQLVRSPSLHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPKQRMGPGAYRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQMYG
Download sequence
Identical sequences H2PKF7
ENSPPYP00000019084 XP_002817458.1.23681 XP_009240568.1.23681 XP_009240570.1.23681 XP_009240571.1.23681 XP_009240572.1.23681 ENSPPYP00000019084 9600.ENSPPYP00000019084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]