SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019159 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019159
Domain Number 1 Region: 235-261,302-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-71
Family Nuclear receptor ligand-binding domain 0.000000000934
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019159   Gene: ENSPPYG00000017112   Transcript: ENSPPYT00000019914
Sequence length 595
Comment pep:known chromosome:PPYG2:6:155060772:155368014:1 gene:ENSPPYG00000017112 transcript:ENSPPYT00000019914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKH
SKKNSPALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGAPVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Download sequence
Identical sequences B6CK17 H2PKN1
XP_002817538.1.23681 XP_002817539.1.23681 XP_003776993.1.23681 XP_009240652.1.23681 9600.ENSPPYP00000019159 ENSPPYP00000019159 ENSPPYP00000019159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]