SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019324 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019324
Domain Number 1 Region: 254-530
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-77
Family Nuclear receptor ligand-binding domain 0.00000000164
Further Details:      
 
Domain Number 2 Region: 202-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000019324
Domain Number - Region: 175-215
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 
Domain Number - Region: 118-127
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019324   Gene: ENSPPYG00000017239   Transcript: ENSPPYT00000020083
Sequence length 536
Comment pep:known chromosome:PPYG2:6_qbl_hap2:1030725:1037600:-1 gene:ENSPPYG00000017239 transcript:ENSPPYT00000020083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAVAGGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSL
SRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQ
KYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences H2PL46
XP_009238093.1.23681 ENSPPYP00000019324 9600.ENSPPYP00000019324 ENSPPYP00000019324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]