SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019388 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019388
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-33
Family Calponin-homology domain, CH-domain 0.0000482
Further Details:      
 
Domain Number 2 Region: 185-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000166
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 214-244
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000057
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019388   Gene: ENSPPYG00000017297   Transcript: ENSPPYT00000020151
Sequence length 905
Comment pep:known chromosome:PPYG2:7:1328032:1356074:-1 gene:ENSPPYG00000017297 transcript:ENSPPYT00000020151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYE
NNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNCFHGRSPIGGMAGVKR
ASEDSEEERSGKKAPVQAARLPSPAPARKPPLSPAQTNPVVQRRNEGAEGPPPKTDQTLA
GSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTLHSGAYRATGEPGAFICTT
HLPAATSASPKLPGLVPRQPGATGVDSRTSCSPQKAQEVNKARPSAWEPAAGNSPARASV
PAAPSPPATSAASVHVRSPARPSESRLALTPTEGKVRPRVTNSSPMGWSSAAQCTAAAAS
HPAVPPSAPDPLPATPQGGGVPRVAAPQTTLSSSSASAATVDPPAWTPSASRTQQARNKF
FQTSAVLPGTSLAGRGPAPSVALSKDSSKEQARNFLKQALSALEEAGALTPGRPSPATAP
VPSSQPKTEAPQASPLAKPSQSTSPRALGLPLRMEPPAPLSTSGTSQASALPPAGRKSLA
ESSGVGRVGAGSRPKPEAPAAKGKSTTLTQDMSASPQEGQEDGPAGWRANLKPVDRRSPA
ERTLKPKEPRALAEPRAGEAPRKVSGSFAGSVHITLTPVRPDRTPHPASPGPSLPARSPS
PPRRRRLAVPASLDVSDNWLRPEPPGQEARVQSWKEEKKPHLQGKPGRPSSPANVPALPG
ETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDSLMVDW
FWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQELL
ERYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKSK
SSPSQ
Download sequence
Identical sequences H2PLA7
ENSPPYP00000019388 ENSPPYP00000019388 9600.ENSPPYP00000019388 XP_002817677.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]