SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019541 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019541
Domain Number 1 Region: 307-368
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000273
Family LIM domain 0.00072
Further Details:      
 
Domain Number 2 Region: 365-435
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000383
Family LIM domain 0.0014
Further Details:      
 
Domain Number 3 Region: 279-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000004
Family LIM domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019541   Gene: ENSPPYG00000017431   Transcript: ENSPPYT00000020312
Sequence length 476
Comment pep:known chromosome:PPYG2:7:9940714:9946989:1 gene:ENSPPYG00000017431 transcript:ENSPPYT00000020312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGALQRTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHVPRRPDP
QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYATASTPAGPAFPVQVKVAQPVRG
CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGGGRGG
EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Download sequence
Identical sequences H2PLQ8
9600.ENSPPYP00000019541 XP_002817826.1.23681 ENSPPYP00000019541 ENSPPYP00000019541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]