SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019606 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019606
Domain Number 1 Region: 322-467
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-30
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 2 Region: 51-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000542
Family LIM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 158-259
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000071
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 109-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000143
Family LIM domain 0.0046
Further Details:      
 
Domain Number 5 Region: 21-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000114
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019606   Gene: ENSPPYG00000017490   Transcript: ENSPPYT00000020378
Sequence length 468
Comment pep:known chromosome:PPYG2:7:13915073:13943867:-1 gene:ENSPPYG00000017490 transcript:ENSPPYT00000020378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTLLCCTWREERMGEEGSELPMCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRSHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMVSPGQSQLPPDSRVRAPQAYLHSMNIIHRDLNSHNCLVRE
Download sequence
Identical sequences H2PLX1
ENSPPYP00000019606 9600.ENSPPYP00000019606 ENSPPYP00000019606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]