SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019637 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019637
Domain Number 1 Region: 188-439
Classification Level Classification E-value
Superfamily VPS9 domain 6.15e-88
Family VPS9 domain 0.000000000168
Further Details:      
 
Domain Number 2 Region: 71-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000699
Family A20-like zinc finger 0.0000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019637   Gene: ENSPPYG00000017520   Transcript: ENSPPYT00000020410
Sequence length 544
Comment pep:novel chromosome:PPYG2:7:21147571:21220717:-1 gene:ENSPPYG00000017520 transcript:ENSPPYT00000020410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYAPCVTCVRCVPGRASRRVGVRRELAAEPRPTRAKWASGGWTPAETRASRKKMSLKSER
RGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEE
AFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGSKKEIQEAKAPSPSI
NRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYH
NVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRW
VTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKN
EPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIE
KLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLLSQLNERQERI
MNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENIENDKLPPPLQPQ
VYAG
Download sequence
Identical sequences H2PM01
ENSPPYP00000019637 ENSPPYP00000019637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]