SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020072 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020072
Domain Number 1 Region: 39-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000012
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.87e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020072   Gene: ENSPPYG00000017906   Transcript: ENSPPYT00000020864
Sequence length 509
Comment pep:known chromosome:PPYG2:7:104070861:104100060:1 gene:ENSPPYG00000017906 transcript:ENSPPYT00000020864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGIMIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF
Download sequence
Identical sequences H2PN71
9600.ENSPPYP00000020072 ENSPPYP00000020072 ENSPPYP00000020072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]