SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020102 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020102
Domain Number 1 Region: 268-332
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000126
Family LIM domain 0.058
Further Details:      
 
Domain Number 2 Region: 328-392
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000018
Family LIM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020102   Gene: ENSPPYG00000017929   Transcript: ENSPPYT00000020894
Sequence length 421
Comment pep:known chromosome:PPYG2:7:112803848:112856388:1 gene:ENSPPYG00000017929 transcript:ENSPPYT00000020894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEED
RKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQ
ALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVK
KYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCK
LSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPR
CAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVV
CQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM
S
Download sequence
Identical sequences A0A2J8UPH8 A4D0U5 K7CDU7 Q2QLF4 Q5RC52 Q9UGI8
9600.ENSPPYP00000020102 9606.ENSP00000350937 ENSPPYP00000020102 ENSP00000350937 ENSPPYP00000020102 ENSP00000350937 ENSPTRP00000043763 ENSPTRP00000043763 gi|7661666|ref|NP_056456.1| ENSP00000350937 NP_001121106.1.37143 NP_001124555.1.23681 NP_056456.1.87134 NP_056456.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]