SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020326 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020326
Domain Number 1 Region: 414-475
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.28e-16
Family LIM domain 0.0026
Further Details:      
 
Domain Number 2 Region: 471-503
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000867
Family LIM domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020326
Domain Number - Region: 376-441
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0218
Family Cytochrome c3-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020326   Gene: ENSPPYG00000018118   Transcript: ENSPPYT00000021123
Sequence length 559
Comment pep:known chromosome:PPYG2:7:140863825:140871333:1 gene:ENSPPYG00000018118 transcript:ENSPPYT00000021123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
LEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAPAPSQTQFHVQPQPQPKPQVQLHV
QSQPQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGH
PEAPSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPSPAQNQTQVRSPGAPGPLTLKEVEE
LEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQ
LQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLE
GTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPESGRNETVRVDCGKPLSIEADDNGC
FPLDGHVLCRKCHTARAQT
Download sequence
Identical sequences H2PNW0
ENSPPYP00000020326 9600.ENSPPYP00000020326 ENSPPYP00000020326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]