SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020561 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020561
Domain Number 1 Region: 195-272
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.56e-19
Family Middle domain of MutM-like DNA repair proteins 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020561
Domain Number - Region: 277-320
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0827
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020561   Gene: ENSPPYG00000018348   Transcript: ENSPPYT00000021388
Sequence length 332
Comment pep:known chromosome:PPYG2:8:8062858:8082665:-1 gene:ENSPPYG00000018348 transcript:ENSPPYT00000021388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQCLWLQDTQVNGKKLFLRFDPDE
EMGPPGSSPPPEPPQKEAQKEGAADPKQVGEPSGQKTPDGSSQSAELVPQGEDDSEYLER
DAPAGDAGRWLRVSFGLFGSVWVNEFSRAKQANKRGDWRDPSPRLVLHFGGGGFLAFYNC
QMSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYR
AGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQRTQVYQREQCPAGHQVMKE
AFGPQDGLQRLTWWCPQCQPQLSEEPEQRQFS
Download sequence
Identical sequences H2PPJ0
XP_009241804.1.23681 9600.ENSPPYP00000020561 ENSPPYP00000020561 ENSPPYP00000020561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]