SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020563 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020563
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00043
Further Details:      
 
Domain Number 2 Region: 211-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020563   Gene: ENSPPYG00000018350   Transcript: ENSPPYT00000021390
Sequence length 442
Comment pep:known chromosome:PPYG2:8:8093430:8161752:-1 gene:ENSPPYG00000018350 transcript:ENSPPYT00000021390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTSAAPSGSESLPPTSGASSNSSNATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPISQSPQT
SSKQDSWNSLVLADSHGDIITA
Download sequence
Identical sequences H2PPJ2
9600.ENSPPYP00000020563 ENSPPYP00000020563 XP_003777251.1.23681 ENSPPYP00000020563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]