SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020646 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020646
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-20
Family PDZ domain 0.0000843
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020646
Domain Number - Region: 312-329
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00684
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020646   Gene: ENSPPYG00000018424   Transcript: ENSPPYT00000021475
Sequence length 366
Comment pep:known chromosome:PPYG2:8:22152416:22171480:1 gene:ENSPPYG00000018424 transcript:ENSPPYT00000021475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLNRSQAASPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRS
SYSSPTSLSPRAVSPFSPPPSSSPLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSVDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI
QEGRYRHPGCYTCADCGLNLKMRGHFWEDPCAMEGMRLSLEALKGMVEGATQRERRKTRR
PIQPSW
Download sequence
Identical sequences H2PPS3
9600.ENSPPYP00000020646 ENSPPYP00000020646 ENSPPYP00000020646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]