SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020962 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020962
Domain Number 1 Region: 1749-1813
Classification Level Classification E-value
Superfamily Homeodomain-like 7.7e-19
Family Homeodomain 0.0045
Further Details:      
 
Domain Number 2 Region: 2116-2186
Classification Level Classification E-value
Superfamily Homeodomain-like 1.07e-18
Family Homeodomain 0.0052
Further Details:      
 
Domain Number 3 Region: 1654-1723
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-16
Family Homeodomain 0.011
Further Details:      
 
Domain Number 4 Region: 2441-2509
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000599
Family Homeodomain 0.0056
Further Details:      
 
Domain Number 5 Region: 1514-1583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000431
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 6 Region: 1372-1419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000709
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number 7 Region: 718-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000235
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020962
Domain Number - Region: 2017-2039,2194-2219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000251
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 2928-2977
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000704
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 1018-1063
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000902
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 1195-1219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00282
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 2663-2672
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 906-951
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00795
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 614-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0235
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number - Region: 1827-1857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0244
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 976-1012
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.1
Family Classic zinc finger, C2H2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020962   Gene: ENSPPYG00000018687   Transcript: ENSPPYT00000021802
Sequence length 3116
Comment pep:known chromosome:PPYG2:8:79392525:79558832:1 gene:ENSPPYG00000018687 transcript:ENSPPYT00000021802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEV
LLGFSVENAAATQVTSAKEIPCNECATSFPSLQKYMEHHCPNARLPVLKDDNESEISELE
DSDVENLTGEIVYQPDGSAYIIEDSKESGQNAQTGANSKLFSTAMFLDSLASAGEKSDQS
ASAPMSFYPQIINTFHIASSLGKPFTADQAFPNTSALAGVGPVLHSFRVYDLRHKREKDY
LTSDGSAKNSCVSKDVPNNVDLSKFDGCVSDGKRKPVLMCFLCKLSFGYIRSFVTHAVHD
HRMTLNDEEQKLLSNKCVSAIIQGIGKDKEPLISFLEPKKSTSVYPHFSTTNLIGPDPTF
RGLWSAFHVENGDSLPAGFAFLKGSASTSSSAEQPLGITQMPKAEVNLGGLSSLVVNTPI
TSVSLSHSSSESSKMSESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSN
ELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSAAVSDDTEKKKQTA
AVRASGSVANNYGISGKDFADASASKDSATAAHPSETARGDEDSSATPHQHGFTPSTPGT
PGPGGEGSPGSGIECPKCDTVLGSSRSLGGHMTMMHSRNSCKTLKCPKCNWHYKYQQTLE
AHMEHPEPGGSCVYCRTGQPHPRLATTTKGNLSIHMQSDKHLNNVQNLQNGNGEQVFGHS
APAPNTSLSGCGTPSPSKPKQKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNM
KQIQHNLHLGLAPAEAELYQYYLAQNIGLTGMKLENPADPQLMINPFQLDPATAAALAPG
LVNNELPPEIRLASGQLMGDDLSLLTAGELSPYISDPALKLFQCAVCNKFTSDSLEALSV
HVSSERSLPEEEWRAVIGDIYQCKLCNYNTQLKANFQLHCKTDKHMQKYQLVAHIKEGGK
SNEWRLKCIAIGNPVHLKCNACDYYTNSVDKLRLHTTNHRHEAALKLYKHLQKQEGAVNP
ESCYYYCAVCDYSTKVKLNLVQHVRSVKHQQTEGLRKLQLHQQGLAPEEDNLSEIFFVKD
CPPNELETASLGARTCDDDLTEQQLRSTSEEQSEEAEGAIKPTAVAEDDEKDTSERDNSE
GKNSNKDSGIITPEKELKVSVAGGTHPLLLAKEEDVATKRSKPTEDNKFCHEQFYQCPYC
NYNSRDQSRIQMHVLSQHSVQPVICCPLCQDVLSNKMHLQLHLTHLHSVSPDCVEKLLMT
VPVPDVMMPNSMLLPAAASEKSERDTPAAVTAGSGYSENPMDDKSMAGLEDSKANVEVKN
EEQKPTKEPLEVSEWNKNSSKDGKIPDTLQDQLNEQQKRQPLSVSDRHVYKYRCNHCSLA
FKTMQKLQIHSQYHAIRAATMCNLCQRSFRTFQALKKHLEAGHPELSEAELQQLYASLPV
NGELWAESETMAQDDHGLEQEMEREYEVDHEGKASPVGSDSSSIPDDMGSEPKRTLPFRK
GPNFTMEKFLDPSRPYKCTVCKESFTQKNILLVHYNSVSHLHKLKKVLQEASSPVPQETN
SNTDNKPYKCSICNVAYSQSSTLEISAPPQVQLPVSLDLPLFPSIMMQPVQHRALPPQLA
LQLPQMDALSADLTQLCQQQLGLDPNFLRHSQFKRPRTRITDDQLKILRAYFDINNSPSE
EQIQEMAEKSGLSQKVIKHWFRNTLFKERQRNKDSPYNFSNPPITVLEDIRIDPQPTSLE
HYKSDASFSKRSSRTRFTDYQLRVLQDFFDTNAYPKDDEIEQLSTVLNLPTRVIVVWFQN
ARQKARKSYENQAETKDNEKRELTNERYIRTSNMQYQCKKCNVVFPRIFDLITHQKKQCY
KDEDDDAQDESQTEDSMDATDQVVYKHCTVSGQTDAAKNAAAPAASSGSGTSTPLIPSPK
PEPEKTSPKPEYPAEKPKQSDPSPPSQGTKPALPLASTSSDPPQASTAQPQPQPQPPKQP
QLIGRPPSASQTPVPSSPLQISMTSLQNSLPPQLLQYQCDQCTVAFPTLELWQEHQHMHF
LAAQNQFLHSPFLERPMDMPYMIFDPNNPLMTGQLLGSSLTQMPPQASSSHTTAPTTVAA
SLKRKLEDKEDNNCSEKEGGNSGEDQHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLD
HIAREVGLKKRVVQVWFQNTRARERKGQFRAVGPAQSHKRCPFCRALFKAKSALESHIRS
RHWNEGKQAGYSLPPSPLISTEDGGESPQKYIYFDYPSLPLTKIDLSSENELASTVSTPV
SKTAELSPKNLLSPSSFKAECSEDVENLNAPPAEAGYDQNKTDFDETSSINTAISDATTG
DEGNTEMESTTGSSGDVKPALSPKEPKTLDTLPKPATTPTTEVCDDKFLFSLTSPSIHFN
DKDGDHDQSFYITDDPDDNADRSETSSIADPSSPNPFGSSNPFKSKSNDRPGHKRFRTQM
SNLQLKVLKACFSDYRTPTMECEMLGNEIGLPQRVVQVWFPNARAKDRKFKIGVKYSARL
SIRDHIFNEKISKVRETVGSQLDKREKDYLAPTTVRQLMAQQELDRIKKASDVLGLAVQQ
PGMMDSSSLHGISLPAAYPGLPGLPPVLLPGMNGPSSLPGFPQNSNTLTPPGAGMLGFPT
SATSSPALSLSSAPTKPLLQTPPPPPPPPPPPPSSSLSGQQTEQQNKESEKKQTKPNKVK
KIKEEELEATKPEKHPKKEEKISSALSVLGKVVGETHVDPTQLQALQNAIAGDPASFIGG
QFLPYFIPGFASYFTPQLPGTVQGGYFPPVCGMESLFPYGPTMPQTLAGLSPGALLQQYQ
QYQQNLQESLQKQQKQQQEQQQKPVQAKTSKVESDQPQNSNDASETKEDKSTATESTKEE
PQLESKSADFSDTYVVPFVKYEFICRKCQMMFTDEDAAVNHQKSFCYFGQPLIDPQETVL
RVPVSKYQCLACDVAISGNEALSQHLQSSLHKEKTIKQAMRNAKEHVRLLPHSVCSPNPN
TTSTSQSAASSNNTYPHLSCFSMKSWPNILFQASARRAASPPSSPPSLSLPSTVTSSLCS
TSGVQTSLPTESCSDESDSELSQKLEDLDNSLEVKAKPASGLDGNFNSIRMDMFSV
Download sequence
Identical sequences H2PQL8
ENSPPYP00000020962 ENSPPYP00000020962 9600.ENSPPYP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]