SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021125 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021125
Domain Number 1 Region: 901-952
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000209
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1229-1276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000402
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021125
Domain Number - Region: 702-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0357
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021125   Gene: ENSPPYG00000018829   Transcript: ENSPPYT00000021968
Sequence length 1294
Comment pep:known chromosome:PPYG2:8:122854926:123114860:-1 gene:ENSPPYG00000018829 transcript:ENSPPYT00000021968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEVNAGYDFTNMVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTD
QSDAAELNHKEEHSLHVQDPSSSSKKDLKSAVLSEKAGFNYESPSKGGNLPSFPHDEVTD
RNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSVETKEDQKMSPKATEETGQA
QSGQANCQGLSPVSVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNIC
GYGYYGNDPTDLIKHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVF
SGVLQDINSSRPVLLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSS
TELEQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSISALRSSDSGDLGKWQDKITVKAGD
DTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGSL
NPELNDKLSRGSVINQNDLAKSSEGETMTKADKSSSGAKKKDFSSKGAEDNVVTSYNCQF
CDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFAC
RKSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQE
ANHLQGSDGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSL
LEHFNTVHCQEQDITTANGEEDGHAISTIKEEPKIDFKVYNLLTPDSKMGEPVSESVVKR
EKLEEKDGLKEKVWTESSSDDLRNVTWRGADILRGSPSYTQASLGLLTPVSGTQEQTKTL
RDSPNVEAAHLARPIYGLAVETKGFLQGVPAGGEKSGALPQQYPASGENKSKDESQSLLR
RRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR
RTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQ
GSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSP
IEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHY
LSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKA
PPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSI
CQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE
Download sequence
Identical sequences H2PR19
ENSPPYP00000021125 ENSPPYP00000021125 XP_002819416.1.23681 XP_009242316.1.23681 9600.ENSPPYP00000021125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]