SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021606 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021606
Domain Number 1 Region: 135-208
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 5.89e-31
Family AN1-like Zinc finger 0.0000177
Further Details:      
 
Domain Number 2 Region: 13-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000185
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021606   Gene: ENSPPYG00000019290   Transcript: ENSPPYT00000022491
Sequence length 213
Comment pep:known chromosome:PPYG2:9:67088977:67093871:-1 gene:ENSPPYG00000019290 transcript:ENSPPYT00000022491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT
SDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVS
EPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY
SDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Download sequence
Identical sequences A0A024R219 A0A096P1S0 A0A0D9R7D4 A0A2K5C198 A0A2K5JQN1 A0A2K5M6H0 A0A2K5RZ93 A0A2K5WK49 A0A2K6A456 A0A2K6C9L4 A0A2K6NQ59 A0A2K6UK19 E2RMV3 F7C2C8 F7HV60 H0V4L7 H2PSD8 K7CGL8 M3X338 O76080
ENSPPYP00000021606 ENSP00000237937 ENSPPYP00000021606 ENSFCAP00000021038 ENSCAFP00000002637 ENSCJAP00000002488 ENSCJAP00000002495 NP_001095890.1.87134 NP_001095890.1.92137 NP_001095891.1.87134 NP_001095891.1.92137 NP_001265172.1.87134 NP_001265172.1.92137 NP_001265173.1.87134 NP_001265173.1.92137 NP_001265174.1.87134 NP_001265174.1.92137 NP_005998.1.87134 NP_005998.1.92137 XP_003732017.1.60252 XP_003935664.1.74449 XP_003935665.1.74449 XP_003995455.1.62641 XP_004637184.1.9945 XP_004637185.1.9945 XP_005004802.1.53824 XP_005388573.1.28644 XP_005581986.1.63531 XP_005581987.1.63531 XP_005615912.1.84170 XP_007077557.1.5354 XP_007967687.1.81039 XP_008973995.1.60992 XP_008993843.1.60252 XP_009455006.1.37143 XP_009455007.2.37143 XP_010374142.1.97406 XP_010374143.1.97406 XP_011769230.1.29376 XP_011769232.1.29376 XP_011802423.1.43180 XP_011802424.1.43180 XP_011820528.1.47321 XP_011820529.1.47321 XP_011912109.1.92194 XP_011912110.1.92194 XP_012309392.1.9421 XP_012309397.1.9421 XP_012309406.1.9421 XP_012309415.1.9421 XP_013010522.1.53824 XP_013973047.1.84170 XP_014201647.1.60992 XP_014918748.1.86478 XP_014973388.1.72884 XP_014973389.1.72884 XP_015292766.1.63531 XP_015390920.1.5354 XP_016816445.1.37143 XP_017361881.1.71028 XP_017361882.1.71028 XP_017828522.1.60252 XP_017828528.1.60252 XP_019319146.1.44245 XP_019319147.1.44245 XP_019671319.1.62641 gi|156231047|ref|NP_001095890.1| gi|156231049|ref|NP_001095891.1| gi|5174755|ref|NP_005998.1| ENSP00000237937 ENSP00000350586 ENSP00000366159 ENSP00000366161 ENSMMUP00000006925 9544.ENSMMUP00000006925 9600.ENSPPYP00000021606 9606.ENSP00000237937 9615.ENSCAFP00000002637 ENSMMUP00000006925 ENSCAFP00000002637 ENSP00000237937 ENSP00000350586 ENSP00000366159 ENSP00000366161 HR6404 O76080 ENSPANP00000019295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]