SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021770 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021770
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.75e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000772
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000143
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021770   Gene: ENSPPYG00000019427   Transcript: ENSPPYT00000022660
Sequence length 273
Comment pep:known chromosome:PPYG2:9:93436730:93458292:-1 gene:ENSPPYG00000019427 transcript:ENSPPYT00000022660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATDGALPEAAALEQPAELPATVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHEPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Download sequence
Identical sequences H2PSU6
9600.ENSPPYP00000021770 ENSPPYP00000021770 ENSPPYP00000021770 XP_002820062.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]