SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021786 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021786
Domain Number 1 Region: 363-624
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-56
Family Nuclear receptor ligand-binding domain 0.0000000164
Further Details:      
 
Domain Number 2 Region: 291-368
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021786   Gene: ENSPPYG00000019442   Transcript: ENSPPYT00000022676
Sequence length 626
Comment pep:known chromosome:PPYG2:9:95628706:95674940:1 gene:ENSPPYG00000019442 transcript:ENSPPYT00000022676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIST
FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPA
SSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGTLWDDALPSAPGCIAPGPLLDPPMKAV
PTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALEG
HPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPNRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC
PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSAL
SMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences H2PSW1
ENSPPYP00000021786 ENSPPYP00000021786 XP_002820080.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]