SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021824 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021824
Domain Number 1 Region: 68-277
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.77e-69
Family alpha-catenin/vinculin 0.00042
Further Details:      
 
Domain Number 2 Region: 556-727
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.79e-42
Family alpha-catenin/vinculin 0.0085
Further Details:      
 
Domain Number 3 Region: 392-524
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.94e-37
Family alpha-catenin/vinculin 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021824
Domain Number - Region: 291-395
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0209
Family FAT domain of focal adhesion kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021824   Gene: ENSPPYG00000019484   Transcript: ENSPPYT00000022720
Sequence length 734
Comment pep:known chromosome:PPYG2:9:105305931:105376968:-1 gene:ENSPPYG00000019484 transcript:ENSPPYT00000022720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKK
SDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDI
TNLNYLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMER
LEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLT
ASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSISIFTGIKEFK
MNIEALRENLYFQSKENLSVTLEVILERTEDFTDSAYTSHEHRERILELSTQARMELQQL
ISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKA
LKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQ
IISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYGYLSLP
KPMKNNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM
SSMAYSLYLFTRGEGPLKTSQDLIHQLEVFAAEGLKLTSSVQAFSKQLKDDDKLMLLLEI
NKLIPLCHQLQTVTKTSLQNKIFLKVDKCITKTRSMMALLVQLLSLCYKLLKKLQMENNG
WVSVTNKDTMDGKT
Download sequence
Identical sequences H2PSZ7
ENSPPYP00000021824 9600.ENSPPYP00000021824 ENSPPYP00000021824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]