SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021980 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021980
Domain Number 1 Region: 185-254
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-20
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 59-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000251
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 29-57
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000108
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021980
Domain Number - Region: 120-148
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0321
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021980   Gene: ENSPPYG00000019614   Transcript: ENSPPYT00000022887
Sequence length 372
Comment pep:known chromosome:PPYG2:9:123492180:123582836:1 gene:ENSPPYG00000019614 transcript:ENSPPYT00000022887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQC
AACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCC
CVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQG
SQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVV
QVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAME
QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQARVGNPID
RLYSMQSSYFAS
Download sequence
Identical sequences A0A0R4J0I7 A0A0S2Z439 A0A1S3FL96 G3TF87 H2PTF0
ENSSTOP00000022763 ENSLAFP00000012975 ENSMUSP00000043616 10090.ENSMUSP00000043616 9600.ENSPPYP00000021980 9606.ENSP00000347684 ENSMUSP00000043616 ENSMUSP00000043616 ENSPPYP00000021980 ENSSTOP00000022763 NP_034855.2.92730 XP_009001275.1.60252 XP_010364182.1.97406 XP_012876799.1.60039 ENSP00000390923 ENSLAFP00000012975 ENSPPYP00000021980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]