SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022147 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022147
Domain Number 1 Region: 195-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-82
Family Nuclear receptor ligand-binding domain 0.000000000875
Further Details:      
 
Domain Number 2 Region: 126-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.38e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022147   Gene: ENSPPYG00000019748   Transcript: ENSPPYT00000023056
Sequence length 456
Comment pep:novel chromosome:PPYG2:9:131369505:131436082:1 gene:ENSPPYG00000019748 transcript:ENSPPYT00000023056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFS
VISSPMGPHSMSVPTTPTLGFGTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGN
MASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNR
CQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKT
ETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN
ELLIASFSNRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTE
LGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALR
SIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences H2PTW3
ENSPPYP00000022147 ENSPPYP00000022147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]