SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022165 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022165
Domain Number 1 Region: 159-222
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 62-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000428
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 31-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000274
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022165   Gene: ENSPPYG00000019765   Transcript: ENSPPYT00000023076
Sequence length 402
Comment pep:known chromosome:PPYG2:9:133138190:133145095:-1 gene:ENSPPYG00000019765 transcript:ENSPPYT00000023076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGELGPARESAGGDLLLALLARRADLRREIPLCAGCDQHILDRFILKALDRHWHSKC
LKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHC
FACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSA
YNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSR
GGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSL
EHGGLAGPEQYRDLRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPPGAPGGP
PPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Download sequence
Identical sequences H2PTY1
9600.ENSPPYP00000022165 ENSPPYP00000022165 ENSPPYP00000022165 XP_002820429.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]