SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022638 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022638
Domain Number 1 Region: 78-162
Classification Level Classification E-value
Superfamily HMG-box 5.63e-25
Family HMG-box 0.0000252
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 2.23e-20
Family HMG-box 0.0000212
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000022638
Domain Number - Region: 176-202
Classification Level Classification E-value
Superfamily ARM repeat 0.0132
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022638   Gene: ENSPPYG00000020229   Transcript: ENSPPYT00000023598
Sequence length 210
Comment pep:known chromosome:PPYG2:X:36798847:36799784:1 gene:ENSPPYG00000020229 transcript:ENSPPYT00000023598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRDPKKPRSKMSSYAFFVQTYQEEHKKKQLDASVSFSEFSKNCSERWKTMSVKEKGKC
EDMAKADKACYEREMKIYPKGETKKKFKDLNAPKMPPSAFFLFCSEYHPKIRGEHPVQST
SDIVKKLGGMWNNTAADEKQPHEKKAAKLKEKCKKDIAAYQAKGKPDAKGVVKVEKSKKK
KEEEEDEEDEDGEEEDEDDDDEKKIEMDGS
Download sequence
Identical sequences H2PV94
9600.ENSPPYP00000022638 ENSPPYP00000022638 ENSPPYP00000022638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]