SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022725 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022725
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 2.28e-46
Family C-type lysozyme 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022725   Gene: ENSPPYG00000020304   Transcript: ENSPPYT00000023687
Sequence length 159
Comment pep:known chromosome:PPYG2:X:48817704:48819545:1 gene:ENSPPYG00000020304 transcript:ENSPPYT00000023687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIMCAKQIVS
SQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP
Download sequence
Identical sequences H2PVH6
9600.ENSPPYP00000022725 ENSPPYP00000022725 ENSPPYP00000022725 XP_002831630.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]