SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022746 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022746
Domain Number 1 Region: 201-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000475
Family Erythroid transcription factor GATA-1 0.00027
Further Details:      
 
Domain Number 2 Region: 249-289
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000162
Family Erythroid transcription factor GATA-1 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022746   Gene: ENSPPYG00000020319   Transcript: ENSPPYT00000023708
Sequence length 290
Comment pep:known chromosome:PPYG2:X:49597908:49600089:1 gene:ENSPPYG00000020319 transcript:ENSPPYT00000023708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA
VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPSSAYGGPDFSSTFFSPTGSPL
NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQ
Download sequence
Identical sequences H2PVJ7
ENSPPYP00000022746 ENSPPYP00000022746 9600.ENSPPYP00000022746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]