SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022865 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022865
Domain Number 1 Region: 142-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-66
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 25-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022865   Gene: ENSPPYG00000020425   Transcript: ENSPPYT00000023828
Sequence length 388
Comment pep:known chromosome:PPYG2:X:65121106:65278459:1 gene:ENSPPYG00000020425 transcript:ENSPPYT00000023828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILWLHSLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQ
KYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSP
TEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQ
LVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFN
EYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELR
MNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDF
PEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences A0A2I3T1P9 F1D8N5 Q5RFF5
ENSP00000379358 gi|58535455|ref|NP_001011645.1| ENSPPYP00000022865 NP_001011645.1.87134 NP_001011645.1.92137 NP_001124649.1.23681 XP_016798174.1.37143 ENSP00000379358 ENSPPYP00000022865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]