SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023242 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023242
Domain Number 1 Region: 145-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.96e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 83-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000411
Family LIM domain 0.0012
Further Details:      
 
Domain Number 3 Region: 23-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000872
Family LIM domain 0.003
Further Details:      
 
Domain Number 4 Region: 204-249
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000109
Family LIM domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023242   Gene: ENSPPYG00000020761   Transcript: ENSPPYT00000024213
Sequence length 339
Comment pep:known chromosome:PPYG2:X:135687308:135702485:1 gene:ENSPPYG00000020761 transcript:ENSPPYT00000024213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
Download sequence
Identical sequences A0A0D9R5D7 A0A1D5QTS1 A0A2I3M6J6 A0A2I3T9X6 A0A2K5W458 A0A2K6DEJ0 A0A2K6L893 A0A2K6QGM6 H2PWW9
XP_001102451.2.72884 XP_003812377.1.60992 XP_004064973.2.27298 XP_004092583.2.23891 XP_005594742.1.63531 XP_006724806.1.92137 XP_007990993.1.81039 XP_009233578.1.23681 XP_010387414.1.97406 XP_011739217.1.29376 XP_011804158.1.43180 XP_011849787.1.47321 XP_016799729.1.37143 XP_017715300.1.44346 ENSPPYP00000023242 ENSPPYP00000023242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]