SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023254 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023254
Domain Number 1 Region: 82-229
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 3.44e-43
Family Ribosomal protein L30p/L7e 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023254
Domain Number - Region: 10-66
Classification Level Classification E-value
Superfamily HMG-box 0.0167
Family HMG-box 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023254   Gene: ENSPPYG00000020770   Transcript: ENSPPYT00000024225
Sequence length 229
Comment pep:known chromosome:PPYG2:X:136301388:136302129:1 gene:ENSPPYG00000020770 transcript:ENSPPYT00000024225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAETIEGVKEKKFPAVPETLKKKWRNFAEPEREVCPKDALKGKEKKMKHYHKEYRQMYRA
EIKIARMARKAGNFLCTRKPELAFVIRIRGSNALSPKVRKLLQLLRLRIFSGTFAKLNKD
SINMLLIVKPYIAWGYPKLKSVNDLIIYKRGYGKINEKSLGKYSIICREDLVNEIYAVGK
RFKETNNFMWPFKLSSPRGGMKKKTTHFVEAGDAGNREDQNKRLLRRMN
Download sequence
Identical sequences H2PWY0
ENSPPYP00000023254 ENSPPYP00000023254 9600.ENSPPYP00000023254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]