SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023303 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023303
Domain Number 1 Region: 81-162
Classification Level Classification E-value
Superfamily HMG-box 4.45e-32
Family HMG-box 0.0000236
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 3.93e-26
Family HMG-box 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023303   Gene: ENSPPYG00000020818   Transcript: ENSPPYT00000024279
Sequence length 199
Comment pep:known chromosome:PPYG2:X:151035182:151040283:1 gene:ENSPPYG00000020818 transcript:ENSPPYT00000024279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEDEEEEEEEEEEEEEGG
Download sequence
Identical sequences H2PX27
ENSPPYP00000023303 ENSPPYP00000023303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]