SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023586 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023586
Domain Number 1 Region: 32-117
Classification Level Classification E-value
Superfamily HMG-box 9.29e-28
Family HMG-box 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023586   Gene: ENSPPYG00000029608   Transcript: ENSPPYT00000032853
Sequence length 238
Comment pep:novel chromosome:PPYG2:8:9169609:9174148:1 gene:ENSPPYG00000029608 transcript:ENSPPYT00000032853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLGAYPWPEGLECPALDAELSDGQSPPAAPRPPGDKGSESRIRRPMNAFMVWAKDER
KRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKK
QAKRLCKRVDPGFLLSSLSRDQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHE
GPASGGGGGTPSSVDTYPYGLPTPPEMSPLDVLEPEQXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences K7ESR9
ENSPPYP00000023586 ENSPPYP00000023586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]