SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023661 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023661
Domain Number 1 Region: 239-306
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-21
Family Homeodomain 0.0034
Further Details:      
 
Domain Number 2 Region: 126-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000159
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 95-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000507
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023661   Gene: ENSPPYG00000029369   Transcript: ENSPPYT00000032927
Sequence length 392
Comment pep:known chromosome:PPYG2:9:119002522:119031100:-1 gene:ENSPPYG00000029369 transcript:ENSPPYT00000032927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWKHENAAPALPEGCRLPAEGGPATDQVMAQPGSGCKATTRCLEGTAPPAMAQSDAEAL
AGALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWH
VRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNA
YHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSE
QDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCR
ARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVH
CRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Download sequence
Identical sequences K7ESZ3
ENSPPYP00000023661 ENSP00000340137 gi|134284359|ref|NP_055183.2| NP_055183.2.87134 NP_055183.2.92137 XP_002820218.1.23681 ENSP00000377854 ENSP00000377854 ENSPPYP00000023661 9606.ENSP00000377854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]