SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023777 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000023777
Domain Number - Region: 339-371
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.087
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023777   Gene: ENSPPYG00000029371   Transcript: ENSPPYT00000033041
Sequence length 371
Comment pep:novel chromosome:PPYG2:X:153089742:153134893:1 gene:ENSPPYG00000029371 transcript:ENSPPYT00000033041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGTTGSRPEGLAAVDIGSERGRLCAAASFASFLEDQDGHSANSQSCKPRPAAISSSPTS
VSAVPADRKSDSTAAQEDAKADPKGALADYEGKNVATKVGEAWQERPGAPRGGQGDPAVP
TQQPADPSTPEQRSSPSGSEQLVGRESCGSSVLADFEGKDVATKVGDAWQDRSGAPRGGQ
GDPAVPTQQPADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIY
IPAPASELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGST
PYSERTTGGICTYCNHEIRDCPKITLEHLGICCHEYCFKCGICSKPMGDLLDQIFIHRDT
IHCGKCYEKLF
Download sequence
Identical sequences K7ETA8
ENSPPYP00000023777 ENSPPYP00000023777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]