SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pongo abelii 69_2 > ENSPPYP00000023804

Domain assignment for ENSPPYP00000023804 from Pongo abelii 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPPYP00000023804
Domain Number 1	Region: 131-190
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.00000000034
Family	TSP-1 type 1 repeat	0.0032
Further Details:

Domain Number 2	Region: 20-83
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000068
Family	TSP-1 type 1 repeat	0.0079
Further Details:

Domain Number 3	Region: 81-132
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.00000327
Family	TSP-1 type 1 repeat	0.0043
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPPYP00000023804 Gene: ENSPPYG00000029455 Transcript: ENSPPYT00000033069
Sequence length	234
Comment	pep:novel chromosome:PPYG2:15:75556779:75561915:1 gene:ENSPPYG00000029455 transcript:ENSPPYT00000033069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MRTAPRWLAPACPPLPPATCHLRPCATWHSGNWNKCSRSCSGGSSVRDMQCVDTWDLRPL QPFHCQPGPAKPPVHRPCGAQPCLSWYTSSWRECSEACGGGEQQCLVTCPEPGLCKEALR PNTTQLCNTHPCTQWVVGPWGQCSAPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPE SSRPCGTDDCEPVEPPCCERDRLSFGFCETLHLLGRCQLPTVRTQCCCLCSAQP
Download sequence
Identical sequences	K7ETD5 ENSPPYP00000023804 ENSPPYP00000023804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]