SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023858 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023858
Domain Number 1 Region: 16-122
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000279
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 317-362
Classification Level Classification E-value
Superfamily RING/U-box 0.000000302
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 254-291
Classification Level Classification E-value
Superfamily SAP domain 0.0000549
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023858   Gene: ENSPPYG00000008177   Transcript: ENSPPYT00000033123
Sequence length 369
Comment pep:novel chromosome:PPYG2:17:29749084:29806640:-1 gene:ENSPPYG00000008177 transcript:ENSPPYT00000033123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKDFIMWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHF
ANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLS
LHDISTEMCREKEELVLLVLGQQPIISQEDRTCASTLSPDFPEQQAFLTQPHSSMVPPTS
PNLPSSSAQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARAPAEDETQSIDSEDSFV
PGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQH
LVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYV
IRAVHVFRS
Download sequence
Identical sequences K7ETI7
ENSPPYP00000023858 ENSPPYP00000023858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]