SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023954 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023954
Domain Number 1 Region: 114-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-48
Family Hypothetical protein AT3g04780/F7O18 27 0.0000555
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.46e-22
Family Thioltransferase 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023954   Gene: ENSPPYG00000009178   Transcript: ENSPPYT00000033218
Sequence length 292
Comment pep:novel chromosome:PPYG2:18:69209986:69244428:-1 gene:ENSPPYG00000009178 transcript:ENSPPYT00000033218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRKIHIGKLRVINL
Download sequence
Identical sequences A0A2I3SXN8 A0A2K5EAF7 A0A2K6TTZ2 K7ETT1
XP_006722643.1.92137 XP_008978120.1.60252 XP_009432333.1.37143 XP_010335082.1.74449 XP_012301867.1.9421 ENSPPYP00000023954 ENSPPYP00000023954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]