SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024108 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024108
Domain Number 1 Region: 131-378
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-68
Family Nuclear receptor ligand-binding domain 0.00000000124
Further Details:      
 
Domain Number 2 Region: 63-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.07e-29
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024108   Gene: ENSPPYG00000018686   Transcript: ENSPPYT00000033371
Sequence length 461
Comment pep:known chromosome:PPYG2:8:78180753:78208904:1 gene:ENSPPYG00000018686 transcript:ENSPPYT00000033371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVSKSMMRVSEPILDMDMANYSEVLDPTYTTLEFETMQILYNSNDSSAPETSMNTTDNG
VNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYC
RLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGSSTD
INIKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKR
SMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFD
PDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQ
FVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPVHPHLSQDPLTGQTILLGPMSTLVHADQ
ISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Download sequence
Identical sequences K7EU84
ENSPPYP00000024108 ENSPPYP00000024108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]