SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024141 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024141
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily HMG-box 0.00000284
Family HMG-box 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024141   Gene: ENSPPYG00000029865   Transcript: ENSPPYT00000033404
Sequence length 55
Comment pep:novel chromosome:PPYG2:6:85355931:85358198:-1 gene:ENSPPYG00000029865 transcript:ENSPPYT00000033404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQDLTDKKQEYLNEYKAEKIEYNESMKAYHNFPVYLAYINAKSLAEAALEEESR
Download sequence
Identical sequences K7EUB7
ENSPPYP00000024141 ENSPPYP00000024141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]