SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024209 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024209
Domain Number 1 Region: 204-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000128
Family Erythroid transcription factor GATA-1 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024209   Gene: ENSPPYG00000029769   Transcript: ENSPPYT00000033471
Sequence length 273
Comment pep:novel chromosome:PPYG2:19:10499884:10504874:-1 gene:ENSPPYG00000029769 transcript:ENSPPYT00000033471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEPIPDSSMPAKLLAPPCLDLEPLGGSPSQEKPRTPGCCRISERSLWPACQDSVTALC
FLQETVERLGQSPAQDTPVLGPCWVPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGT
PSVPPQRRPRKQLNPCRGTEKVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPA
DAVGGPADHPGGTEAHSAGSEALEPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYG
TRCSRCWLVPRKNVQPKRLCGRCGVSLDPIQEG
Download sequence
Identical sequences K7EUI4
ENSPPYP00000024209 ENSPPYP00000024209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]