SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024211 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024211
Domain Number 1 Region: 155-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.39e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 2 Region: 97-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.06e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 61-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000784
Family LIM domain 0.00044
Further Details:      
 
Domain Number 4 Region: 7-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000952
Family LIM domain 0.0024
Further Details:      
 
Domain Number 5 Region: 32-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.0009
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024211
Domain Number - Region: 214-243
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0154
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024211   Gene: ENSPPYG00000029627   Transcript: ENSPPYT00000033473
Sequence length 272
Comment pep:novel chromosome:PPYG2:2a_random:8334455:8344900:1 gene:ENSPPYG00000029627 transcript:ENSPPYT00000033473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNR
EKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPC
HDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHY
NQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKDKFVEIDLKPVCKHCY
EKMPEEFKRRLAKREREAKDKDKQKKKKPVCL
Download sequence
Identical sequences K7EUI6
ENSPPYP00000024211 ENSPPYP00000024211 XP_002832613.2.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]