SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024384 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024384
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 586-650
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2e-18
Family LIM domain 0.0092
Further Details:      
 
Domain Number 3 Region: 527-590
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.72e-18
Family LIM domain 0.0099
Further Details:      
 
Domain Number 4 Region: 494-525
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000117
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 646-670
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000209
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024384   Gene: ENSPPYG00000002271   Transcript: ENSPPYT00000033646
Sequence length 677
Comment pep:novel chromosome:PPYG2:10:48040874:48106036:-1 gene:ENSPPYG00000002271 transcript:ENSPPYT00000033646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKVVVNSPANADYQE
RFNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSD
FSGASPLASLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQSRSFRILAQMT
GTEFMQDPDEEALRRSSTPIEHAPVCTSQATTPLLPASAQPPAAASPSAASPPLATAAAH
TAIASASATAPASSPAESPRPQASSYSPAVAASSAPATHTSYSEGPAAPAPKPRVVTTAS
IRPSVYQPVPASTYSPSPGANYSPTPYTPSPAPAYTPSPVPTYTPSPAPAYTPSPAPNYN
PAPSVAYSGGPAEPASRPPWVTDDSFSQKFAPGKSTTSVSKQTLPRGGPAYTPAGPQVPP
LARGTVQRAERFPASSRTPLCGHCNNVIRGPFLVAMGRSWHPEEFTCAYCKTSLADVCFV
EEQNNVYCERCYEQFFAPLCAKCNTKIMGEVMHALRQTWHTTCFVCAACKKPFGNSLFHM
EDGEPYCEKDYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFY
SKKDRPLCKKHAHTINL
Download sequence
Identical sequences K7EV07
ENSPPYP00000024384 ENSPPYP00000024384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]