SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000002 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000002
Domain Number 1 Region: 237-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.63e-16
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 2 Region: 168-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000633
Family Classic zinc finger, C2H2 0.00076
Further Details:      
 
Domain Number 3 Region: 193-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000332
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000002   Gene: ENSPPYG00000000002   Transcript: ENSPPYT00000000002
Sequence length 359
Comment pep:known chromosome:PPYG2:1:116903:123642:1 gene:ENSPPYG00000000002 transcript:ENSPPYT00000000002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEDDDEDEEEMLSDASLWTYSSSPDD
SEPDAPRLRPSPVTCTPKEGETPPSPAALSTPLALPSLSASSLSSRAPPPAEVRVQPELS
RTPQAAQQTEALASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFS
NRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRT
SSNLVIHRRIHTGEKPLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKP
DSVAAHCSKSHPALLLAPQESPSGPLEPCPSISAPGPLGSSEGSRPSASPQAPTLLPQQ
Download sequence
Identical sequences H2N336
ENSPPYP00000000002 ENSPPYP00000000002 9600.ENSPPYP00000000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]