SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000034 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000034
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 2.71e-24
Family Pyrin domain, PYD 0.0058
Further Details:      
 
Domain Number 2 Region: 215-307,338-388
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000612
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000000034
Domain Number - Region: 109-187
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 0.0418
Family USP8 N-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000034   Gene: ENSPPYG00000000036   Transcript: ENSPPYT00000000039
Sequence length 718
Comment pep:known chromosome:PPYG2:1:1561601:1568520:-1 gene:ENSPPYG00000000036 transcript:ENSPPYT00000000039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICREDSTEEEWMGL
LEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQ
QEREQELLAIGKTKMCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKIM
LDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQH
LLDHPRHVEILGFSEAKRKEYFFKYFSDEAQAKAAFSLIQENEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHCLCAHLWGLCSLAADGIWNQ
KILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEK
EGRTNVPGSLLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTR
MDHVVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPGSSHAACSH
Download sequence
Identical sequences H2N368
ENSPPYP00000000034 ENSPPYP00000000034 9600.ENSPPYP00000000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]