SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000617 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000617
Domain Number 1 Region: 2037-2195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.48e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000354
Further Details:      
 
Domain Number 2 Region: 1876-2036
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.86e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000174
Further Details:      
 
Domain Number 3 Region: 1550-1732
Classification Level Classification E-value
Superfamily Cupredoxins 2.58e-49
Family Multidomain cupredoxins 0.0000268
Further Details:      
 
Domain Number 4 Region: 349-534
Classification Level Classification E-value
Superfamily Cupredoxins 6.75e-46
Family Multidomain cupredoxins 0.0000573
Further Details:      
 
Domain Number 5 Region: 31-204
Classification Level Classification E-value
Superfamily Cupredoxins 9.17e-46
Family Multidomain cupredoxins 0.0000000923
Further Details:      
 
Domain Number 6 Region: 541-672
Classification Level Classification E-value
Superfamily Cupredoxins 2.92e-34
Family Multidomain cupredoxins 0.00023
Further Details:      
 
Domain Number 7 Region: 1739-1876
Classification Level Classification E-value
Superfamily Cupredoxins 1.17e-32
Family Multidomain cupredoxins 0.00000174
Further Details:      
 
Domain Number 8 Region: 207-329
Classification Level Classification E-value
Superfamily Cupredoxins 8.6e-32
Family Multidomain cupredoxins 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000617   Gene: ENSPPYG00000000531   Transcript: ENSPPYT00000000642
Sequence length 2196
Comment pep:known chromosome:PPYG2:1:81575142:81650472:1 gene:ENSPPYG00000000531 transcript:ENSPPYT00000000642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSATS
FKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYS
KLSEGASYLDHTFPVEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIE
DFNSGLIGPLLICKKGTLTEDGTQKMFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNA
TMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAVTLVSATSTTANMTV
GPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNPKKITREQRRHMKRWEYFIAAEEVI
WDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILG
PIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET
YTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAA
DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSNFTLSAINGYVPE
SIPTLGFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTM
DNVGTWMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEP
EDEESDADYDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALALENGTEFISSNTDIIVVS
NYSSPSNISKLTVNNLEETQKTPSHQQATTAGSPLRHLIGKNSVLNSSTAEHSSPYSEDP
IEDPLQPDVTGIRLLSLGAGEFKSQEHAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLS
QDTRSPSGMRPWEDLPSDLLLLKQNNPSKILVGRWHLASEKGSYEIIQDTDEHTAVNNWL
ISPQNASRAWGESTPLANKPGKQSGHPKFPTVRHKSLQVRQDGGKSRLKKSQFLIKTRKK
KKEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSLFLHKSNETSLPTDLNQTLPSMDFD
WIASLPDHNQNSSNDTGQTSSPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPE
LSEMLEYDRSHRSFPTDISQMSPSSEHEVWQTITSPDLSQVTLSPELSQTNLSPAFGQMP
ISPDRSHTTLSPDLSHTTLSPDLSHTTLSLDLSQTNLSPELSQTNLSPALSQMPLSPDLS
HTTLSLDLSQTNLSPELSHRTLSLSPALGQMPISPDLSHTTLSLDFSQTNLSPELSQTNL
SPALGQMPLSPDPSHTTLSLDLSQPNLSPELSQTNLSPDLSEMPIFADLSQIPLTPDLDQ
MTLSPDLGETDLSSDFGQMSLSPDLSQVTLFPDISDTTLPPDLSQISPPPDLDQIFYPSE
SSQSLLLPEFNETFPYPDLGQMPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPK
EEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRNPDNIAAWYLRSNNGNRRNYYIAAEE
ISWDYSEFVQRERDIEDSDDIPEDTIYKKVVFRKYLDSTFTKRDPQGEYEEHLGILGPII
RAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAVQPNSSYTY
VWHATERSGPESPGSACRAWAYYSAVNPEKDIHSGLIGPLLICQKGILHKDSNMPVDMRE
FVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMKKSHEFHAINGMIYSLPGLRMYEQEWVRL
HLLNIGDSQDIHVVHFHGQTLLENGNKQHQLGVWPLLPGSFKTLEMKASKPGWWLLNTEV
GENQRAGMQTPFLIMDRDCRMPMGLSTGIISDSQIKASEFLGYWEPRLARLNNGGSYNAW
SVEKLAAEFASKPWIQVDMQKEVIITGIQTQGAKHYLKSCYTTEFYVAYSSNQINWQIFK
GNSTRNVMYFNGNSDASTIKENQFDPPIVARYIRISPTQAYNRPTLRLELQGCEVNGCST
PLGIENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLL
KIKKITAIITQGCKSLSSEMYVKSYTIHYSDQGVEWKPYRLKSSMVDKIFEGNTNTKGHV
KNFFNPPIISRFIRVIPKTWNQSIALRLELFGCDIY
Download sequence
Identical sequences H2N4S8
9600.ENSPPYP00000000617 ENSPPYP00000000617 ENSPPYP00000000617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]