SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000995 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000995
Domain Number 1 Region: 395-631
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-63
Family Nuclear receptor ligand-binding domain 0.000000586
Further Details:      
 
Domain Number 2 Region: 152-236
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000995   Gene: ENSPPYG00000000853   Transcript: ENSPPYT00000001028
Sequence length 642
Comment pep:known chromosome:PPYG2:1:99749524:99775938:1 gene:ENSPPYG00000000853 transcript:ENSPPYT00000001028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPGARTLCQPLLLPACWRARCSRLPPSALLPPLGPAPCPPGQPGQPGRHQGSCPMDRA
PQRQHQASRGKRPMALPAGGRDCRRFRGQKWQKTGQEVRRGGRDKSAEEKALGWQGVRHQ
GSCPMDRAPQRQHQASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFR
RSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHA
EVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGL
LKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEH
RHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQR
SNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAG
AMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDE
IALYTALVLINAYRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLC
SQHVERLQIFQHLHPIVVQATFPPLYKELFSTETESPVGLSK
Download sequence
Identical sequences H2N5U0
ENSPPYP00000000995 ENSPPYP00000000995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]