SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001122 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001122
Domain Number 1 Region: 458-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 514-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-19
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 326-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 555-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-18
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 375-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000148
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001122
Domain Number - Region: 254-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000543
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001122   Gene: ENSPPYG00000000963   Transcript: ENSPPYT00000001159
Sequence length 613
Comment pep:novel chromosome:PPYG2:1:108405305:108431083:1 gene:ENSPPYG00000000963 transcript:ENSPPYT00000001159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPASEPASQPASQPASQRATQRPLQPPPHKGRRAAVRGSGRGARCPSSSPRQRPRRDSWS
PPLLFSSWMKQEDNQGVCAHQDSEDKGMGSDFEDSEDREGDPEGREMGSNPQDTNKREGQ
LEPEMGSNPQDSRHREAVPDICREGQVSEEEGVSVRGEEDDQSGVADIAMFPGLSESDSI
SRSLREDDDESAGENRLEEEEEQPAPPVLPWRRHLSLGSRHRGDKPAHRRFHRLHHPMAV
DLGELDSLVASIMDAPTICPDCGESFSPGAAFLQHQRIHRLAEAAAAASLEPFGLAGECD
AMVGMMGVGVAGGFGAGPPLARPPREKPFRCGECGKGFSRNTYLTNHLRLHTGERPNLCA
DCGKSFSWRADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAAASGAGAAALRP
FACGECGKGFVRRSHLANHQRIHTGEKPHGCGECGKRFSWRSDLVKHQRVHTGEKPYMCS
ECGETFSVSSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEK
RFSDFSTLTQHQRTHTGEKPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRY
KTHLAQHQKLHLC
Download sequence
Identical sequences H2N662
ENSPPYP00000001122 ENSPPYP00000001122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]