SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001241 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001241
Domain Number 1 Region: 32-61,179-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.57e-63
Family G proteins 0.0000000205
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.57e-43
Family Transducin (alpha subunit), insertion domain 0.000000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001241   Gene: ENSPPYG00000001069   Transcript: ENSPPYT00000001283
Sequence length 354
Comment pep:known chromosome:PPYG2:1:118676543:118720081:-1 gene:ENSPPYG00000001069 transcript:ENSPPYT00000001283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
Download sequence
Identical sequences A0A096NWS6 A0A2I3HE78 A0A2K5LLH1 A0A2K5ZEK6 A0A2K6MY97 A0A2K6PMI8 F6VL43 G3SCU6 G7NW34 H2N6H9 H2PZK9 P08754
ENSGGOP00000000510 ENSGGOP00000025924 ENSP00000358867 ENSMMUP00000007669 ENSNLEP00000003593 ENSPTRP00000001821 ENSPANP00000017508 gi|5729850|ref|NP_006487.1| ENSPPYP00000001241 ENSPPYP00000001241 ENSP00000358867 ENSMMUP00000007669 9544.ENSMMUP00000007669 9598.ENSPTRP00000001821 9600.ENSPPYP00000001241 9606.ENSP00000358867 ENSGGOP00000000510 ENSNLEP00000003593 NP_001252902.1.72884 NP_006487.1.87134 NP_006487.1.92137 XP_002810535.1.23681 XP_003267953.1.23891 XP_003804941.1.60992 XP_004026320.1.27298 XP_005542522.1.63531 XP_010353870.1.97406 XP_011824087.1.47321 XP_011933671.1.92194 XP_017714260.1.44346 XP_513624.1.37143 ENSP00000358867 ENSPTRP00000001821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]