SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001372 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000001372
Domain Number - Region: 31-73
Classification Level Classification E-value
Superfamily SRCR-like 0.0602
Family Scavenger receptor cysteine-rich (SRCR) domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001372   Gene: ENSPPYG00000001184   Transcript: ENSPPYT00000001417
Sequence length 95
Comment pep:known chromosome:PPYG2:1:142002967:142052607:1 gene:ENSPPYG00000001184 transcript:ENSPPYT00000001417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQ
FNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCG
Download sequence
Identical sequences D3DT21 H2N6V5
ENSPPYP00000001372 ENSPPYP00000001372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]