SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001374 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001374
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.27e-69
Family BAR domain 0.00045
Further Details:      
 
Domain Number 2 Region: 244-276,307-364
Classification Level Classification E-value
Superfamily SH3-domain 2.5e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001374   Gene: ENSPPYG00000001185   Transcript: ENSPPYT00000001419
Sequence length 365
Comment pep:known chromosome:PPYG2:1:142174774:142216225:-1 gene:ENSPPYG00000001185 transcript:ENSPPYT00000001419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSD
LKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY
LELLN
Download sequence
Identical sequences A0A140VJU5 A0A2J8SKV3 K7DSD6 Q5R8P5 Q9Y371
gi|7705773|ref|NP_057093.1| ENSPPYP00000001374 GO.36632 HR3106 ENSP00000473267 9606.ENSP00000212369 ENSPPYP00000001374 ENSP00000473267 NP_057093.1.87134 NP_057093.1.92137 XP_003805352.1.60992 XP_016811449.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]