SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002744 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002744
Domain Number 1 Region: 568-650
Classification Level Classification E-value
Superfamily DEATH domain 2.83e-22
Family DEATH domain, DD 0.00000813
Further Details:      
 
Domain Number 2 Region: 15-62
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002744   Gene: ENSPPYG00000002362   Transcript: ENSPPYT00000002837
Sequence length 658
Comment pep:novel chromosome:PPYG2:10:63874359:63885527:-1 gene:ENSPPYG00000002362 transcript:ENSPPYT00000002837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCAHAPVYHALTVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSK
NCTDGLCMQNKKTLSDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDF
DTDITDSSAALTGGFHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKI
PMTNSPLLDPLPSLKVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFAQDTHFLHLRS
ASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINK
AESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTLPHCAEVSARDWIFQLKTQAHQGHW
EEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCT
SLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHW
RKLLAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELICKICVRQVEGEGQIFQLHTT
LAETPAGSLDTLCSAPGSTITTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKL
SMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC
Download sequence
Identical sequences H2NAM6
ENSPPYP00000002744 ENSPPYP00000002744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]